PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00123390001
Common NameGSBRNA2T00123390001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 417aa    MW: 46882.3 Da    PI: 6.5648
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00123390001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.5e-3292145255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrWtpeLH +F++ave+LGG+++AtPk +l+lm+vkgL+++hvkSHLQ+YR+
  GSBRNA2T00123390001  92 PRLRWTPELHLCFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRS 145
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-3088146IPR009057Homeodomain-like
PROSITE profilePS5129414.02588148IPR017930Myb domain
SuperFamilySSF466895.55E-1689146IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-2492147IPR006447Myb domain, plants
PfamPF002491.0E-993144IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MTPSSQSSEN SKTCPSNNFK ATTTKEDNDK DEEEEEEEEE EEEEDEEERS ADQSPSSNSY  60
VEESGSQHHH NNNDQIKKNG GSVRPYNRSK TPRLRWTPEL HLCFLQAVER LGGPDRATPK  120
LVLQLMNVKG LSIAHVKSHL QMYRSKKIDD LNQGDQGFSF EHGAGYTYNL SQPPMLQSFD  180
QGPSTSLGYG GGSWIDHRRQ VYRSPWRGLT ARDNTRTRQT LFSSQLGERF HGVSNSILDD  240
KNKTISFRTN SREAAHASNG IGEAVPRSHR SFLEGMKTFN KSWGQSFPSN PNPSMPSKPQ  300
DHTAVTLNFH QSDNPRVGEE TENDLKRKRL LLSGDYNKSN PDLDLSLSLK VPPTHNNLGE  360
CLLEEGEKEH EDSKRLSLSL SSSSLSQHGR AIRKEDQNDH KKRKISVLAS PLDLTL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00123390001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325720.0AC232572.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS005G02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141879.10.0PREDICTED: two-component response regulator ARR1-like isoform X2
TrEMBLA0A078EYA60.0A0A078EYA6_BRANA; BnaA04g22450D protein
STRINGBra004973.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93592136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.10.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]